Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YOR376W-A  from Saccharomyces cerevisiae S288C
>YOR376W-A|YOR376W-A YOR376W-A SGDID:S000028586, Chr XV from 1045196-1045351, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; identified by fungal homology and RT-PCR" ORGANISM: Saccharomyces cerevisiae S288C (51 aa)
MTFHLGWTILWYNQAYLEVWATVFQDEMHKYSLHPQSRDAKTKFCCCIPFK