Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOR369C  from Saccharomyces cerevisiae S288C
>YOR369C|YOR369C RPS12 SGDID:S000005896, Chr XV from 1028625-1028194, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; has similarity to rat ribosomal protein S12" ORGANISM: Saccharomyces cerevisiae S288C (143 aa)
MSDVEEVVEVQEETVVEQTAEVTIEDALKVVLRTALVHDGLARGLRESTKALTRGEALLV
VLVSSVTEANIIKLVEGLANDPENKVPLIKVADAKQLGEWAGLGKIDREGNARKVVGASV
VVVKNWGAETDELSMIMEHFSQQ