Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOR367W  from Saccharomyces cerevisiae S288C
>YOR367W|YOR367W SCP1 SGDID:S000005894, Chr XV from 1026007-1026609, Genome Release 64-1-1, Verified ORF, "Component of yeast cortical actin cytoskeleton, binds and cross links actin filaments; originally identified by its homology to calponin (contains a calponin-like repeat) but the Scp1p domain structure is more similar to transgelin" ORGANISM: Saccharomyces cerevisiae S288C (200 aa)
MSYDKKADVTSLDEDLRQLRESKFSPEAIQNIKIWVYKSVLKEIAPPGDLLECLKDGTVL
CKLANILYEADTGEANHISWKSSKMPFVQMDQISQFLSFSRKYGVPEDELFQTIDLFEKK
DPAIVFQTLKSLSRYANKKHTDRFPVLGPQLSTKKPRPPVKSKPKHLQDGTGWSTFEYGY
MKGASQATEGVVLGQRRDIV