Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOR357C  from Saccharomyces cerevisiae S288C
>YOR357C|YOR357C SNX3 SGDID:S000005884, Chr XV from 1009712-1009224, Genome Release 64-1-1, reverse complement, Verified ORF, "Sorting nexin required to maintain late-Golgi resident enzymes in their proper location by recycling molecules from the prevacuolar compartment; contains a PX domain and sequence similarity to human Snx3p" ORGANISM: Saccharomyces cerevisiae S288C (162 aa)
MPREFKSFGSTEKSLLSKGHGEPSYSEIYAEPENFLEIEVHNPKTHIPNGMDSKGMFTDY
EIICRTNLPSFHKRVSKVRRRYSDFEFFRKCLIKEISMLNHPKVMVPHLPGKILLSNRFS
NEVIEERRQGLNTWMQSVAGHPLLQSGSKVLVRFIEAEKFVG