Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOR339C  from Saccharomyces cerevisiae S288C
>YOR339C|YOR339C UBC11 SGDID:S000005866, Chr XV from 958832-958362, Genome Release 64-1-1, reverse complement, Verified ORF, "Ubiquitin-conjugating enzyme most similar in sequence to Xenopus ubiquitin-conjugating enzyme E2-C, but not a true functional homolog of this E2; unlike E2-C, not required for the degradation of mitotic cyclin Clb2" ORGANISM: Saccharomyces cerevisiae S288C (156 aa)
MAVEEGGCVTKRLQNELLQLLSSTTESISAFPVDDNDLTYWVGYITGPKDTPYSGLKFKV
SLKFPQNYPFHPPMIKFLSPMWHPNVDKSGNICLDILKEKWSAVYNVETILLSLQSLLGE
PNNRSPLNAVAAELWDADMEEYRKKVLACYEEIDDY