Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOR327C  from Saccharomyces cerevisiae S288C
>YOR327C|YOR327C SNC2 SGDID:S000005854, Chr XV from 931081-930734, Genome Release 64-1-1, reverse complement, Verified ORF, "Vesicle membrane receptor protein (v-SNARE) involved in the fusion between Golgi-derived secretory vesicles with the plasma membrane; member of the synaptobrevin/VAMP family of R-type v-SNARE proteins" ORGANISM: Saccharomyces cerevisiae S288C (115 aa)
MSSSVPYDPYVPPEESNSGANPNSQNKTAALRQEIDDTVGIMRDNINKVAERGERLTSIE
DKADNLAISAQGFKRGANRVRKQMWWKDLKMRMCLFLVVIILLVVIIVPIVVHFS