Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOR319W  from Saccharomyces cerevisiae S288C
>YOR319W|YOR319W HSH49 SGDID:S000005846, Chr XV from 912822-913463, Genome Release 64-1-1, Verified ORF, "U2-snRNP associated splicing factor with similarity to the mammalian splicing factor SAP49; proposed to function as a U2-snRNP assembly factor along with Hsh155p and binding partner Cus1p; contains two RNA recognition motifs (RRM)" ORGANISM: Saccharomyces cerevisiae S288C (213 aa)
MNYSADSGNTVYVGNIDPRITKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEFYNQ
GDAQYAIKIMNNTVRLYDRLIKVRQVTNSTGTTNLPSNISKDMILPIAKLFIKNLADSID
SDQLVKIFNKFGKLIREPEIFYLSNGKLKCAYVYFEDFEKADLAIKSLNNQLVANNRITV
DYAFKENGKGNAKYGDDVDRLLNKEALKHNMLK