Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YOR316C-A  from Saccharomyces cerevisiae S288C
>YOR316C-A|YOR316C-A YOR316C-A SGDID:S000028584, Chr XV from 907935-907726, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; identified by fungal homology and RT-PCR" ORGANISM: Saccharomyces cerevisiae S288C (69 aa)
MLVPMHNSPTAANGRLSLTVASSGLRKGKKNRVYTIHSYIRSPVSSSEFSFSVRRQYKLT
IRIKQKTHL