Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOR304C-A  from Saccharomyces cerevisiae S288C
>YOR304C-A|YOR304C-A YOR304C-A SGDID:S000005830, Chr XV from 888750-888520, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery, cytoplasm, bud, and bud neck" ORGANISM: Saccharomyces cerevisiae S288C (76 aa)
MSTEKLEASEEPQAPLANTSETNSIKGDTENIVTVFDLANEIEKSLKDVQRQMKENDDEF
SRSIQAIEDKLNKMSR