Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOR298C-A  from Saccharomyces cerevisiae S288C
>YOR298C-A|YOR298C-A MBF1 SGDID:S000007253, Chr XV from 877685-877230, Genome Release 64-1-1, reverse complement, Verified ORF, "Transcriptional coactivator that bridges the DNA-binding region of Gcn4p and TATA-binding protein Spt15p; suppressor of frameshift mutations" ORGANISM: Saccharomyces cerevisiae S288C (151 aa)
MSDWDTNTIIGSRARAGGSGPRANVARSQGQINAARRQGLVVSVDKKYGSTNTRGDNEGQ
RLTKVDRETDIVKPKKLDPNVGRAISRARTDKKMSQKDLATKINEKPTVVNDYEAARAIP
NQQVLSKLERALGVKLRGNNIGSPLGAPKKK