Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YOR293C-A  from Saccharomyces cerevisiae S288C
>YOR293C-A|YOR293C-A YOR293C-A SGDID:S000028858, Chr XV from 868147-867998, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; identified by expression profiling and mass spectrometry" ORGANISM: Saccharomyces cerevisiae S288C (49 aa)
MKLLFLNIIVVRRHLHCKSYRLSPWYIYIYGDYLLYTTEIPYKPFTRQP