Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOR286W  from Saccharomyces cerevisiae S288C
>YOR286W|YOR286W RDL2 SGDID:S000005812, Chr XV from 850280-850729, Genome Release 64-1-1, Verified ORF, "Protein with rhodanese activity; contains a rhodanese-like domain similar to Rdl1p, Uba4p, Tum1p, and Ych1p; overexpression causes a cell cycle delay; null mutant displays elevated frequency of mitochondrial genome loss" ORGANISM: Saccharomyces cerevisiae S288C (149 aa)
MFKHSTGILSRTVSARSPTLVLRTFTTKAPKIYTFDQVRNLVEHPNDKKLLVDVREPKEV
KDYKMPTTINIPVNSAPGALGLPEKEFHKVFQFAKPPHDKELIFLCAKGVRAKTAEELAR
SYGYENTGIYPGSITEWLAKGGADVKPKK