Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOR285W  from Saccharomyces cerevisiae S288C
>YOR285W|YOR285W RDL1 SGDID:S000005811, Chr XV from 849635-850054, Genome Release 64-1-1, Verified ORF, "Protein of unknown function containing a rhodanese-like domain; localized to the mitochondrial outer membrane" ORGANISM: Saccharomyces cerevisiae S288C (139 aa)
MWKAVMNAWNGTESQSKNVSNIQSYSFEDMKRIVGKHDPNVVLVDVREPSEYSIVHIPAS
INVPYRSHPDAFALDPLEFEKQIGIPKPDSAKELIFYCASGKRGGEAQKVASSHGYSNTS
LYPGSMNDWVSHGGDKLDL