Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOR276W  from Saccharomyces cerevisiae S288C
>YOR276W|YOR276W CAF20 SGDID:S000005802, Chr XV from 841333-841818, Genome Release 64-1-1, Verified ORF, "Phosphoprotein of the mRNA cap-binding complex involved in translational control, repressor of cap-dependent translation initiation, competes with eIF4G for binding to eIF4E" ORGANISM: Saccharomyces cerevisiae S288C (161 aa)
MIKYTIDELFQLKPSLTLEVNFDAVEFRAIIEKVKQLQHLKEEEFNSHHVGHFGRRRSSH
HHGRPKIKHNKPKVTTDSDGWCTFEAKKKGSGEDDEEETETTPTSTVPVATIAQETLKVK
PNNKNISSNRPADTRDIVADKPILGFNAFAALESEDEDDEA