Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOR268C  from Saccharomyces cerevisiae S288C
>YOR268C|YOR268C YOR268C SGDID:S000005794, Chr XV from 825932-825534, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; sporulation is abnormal in homozygous diploid; YOR268C is not an essential gene" ORGANISM: Saccharomyces cerevisiae S288C (132 aa)
MVFVFPFPFFSYGFSSFLEAGKKASYKMYYAEPELKTTRTGRAVACDAGSPRIIRVTLKD
KIGLSERFTGRVFCYLAVACAWLSQYYHHTCAFFILYVHVCVCFLFFRWCLFATVSLIHE
SQTQAGSAYYTK