Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOR265W  from Saccharomyces cerevisiae S288C
>YOR265W|YOR265W RBL2 SGDID:S000005791, Chr XV from 820454-820774, Genome Release 64-1-1, Verified ORF, "Protein involved in microtubule morphogenesis, required for protection from excess free beta-tubulin; proposed to be involved the folding of beta-tubulin; similar to mouse beta-tubulin cofactor A" ORGANISM: Saccharomyces cerevisiae S288C (106 aa)
MAPTQLDIKVKALKRLTKEEGYYQQELKDQEAHVAKLKEDKSVDPYDLKKQEEVLDDTKR
LLPTLYEKIREFKEDLEQFLKTYQGTEDVSDARSAITSAQELLDSK