Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOR258W  from Saccharomyces cerevisiae S288C
>YOR258W|YOR258W HNT3 SGDID:S000005784, Chr XV from 811671-812324, Genome Release 64-1-1, Verified ORF, "DNA 5' AMP hydrolase involved in DNA repair; member of the histidine triad (HIT) superfamily of nucleotide-binding proteins; homolog of Aprataxin, a Hint related protein that is mutated in individuals with ataxia with oculomotor apraxia" ORGANISM: Saccharomyces cerevisiae S288C (217 aa)
MSWRYALKNYVTSPETVNDDTVTYFDDKVSIIRDSFPKSECHLLILPRTMQLSRSHPTKV
IDAKFKNEFESYVNSAIDHIFRHFQEKFRIKKSDDDKDPCWDDILKDKNKFVRNFVQVGI
HSVPSMANLHIHVISKDFHSVRLKNKKHYNSFNTGFFISWDDLPLNGKNLGTDKEIETTY
LKEHDLLCCYCQRNFSNKFSLLKKHLELEFNSHFELK