Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOR247W  from Saccharomyces cerevisiae S288C
>YOR247W|YOR247W SRL1 SGDID:S000005773, Chr XV from 797676-798308, Genome Release 64-1-1, Verified ORF, "Mannoprotein that exhibits a tight association with the cell wall, required for cell wall stability in the absence of GPI-anchored mannoproteins; has a high serine-threonine content; expression is induced in cell wall mutants" ORGANISM: Saccharomyces cerevisiae S288C (210 aa)
MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADDTTTFFVTSTV
YSTSWFTSTSATITNAASSSLSTSSASGSVTPESTHEITSTSTITSTLLLTLHDSTTLSP
SSTAASVSDEDSNNKDAKVKSFEQASTSNGCVPITKFVTVTNEPVTQYVTVTPNTTTQYV
TVTGAPSVTTTSPGNVQWYNTTSITNSTSW