Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOR234C  from Saccharomyces cerevisiae S288C
>YOR234C|YOR234C RPL33B SGDID:S000005760, Chr XV from 778859-778555,779405-779387, Genome Release 64-1-1, reverse complement, Verified ORF, "Ribosomal protein L37 of the large (60S) ribosomal subunit, nearly identical to Rpl33Ap and has similarity to rat L35a; rpl33b null mutant exhibits normal growth while rpl33a rpl33b double null mutant is inviable" ORGANISM: Saccharomyces cerevisiae S288C (107 aa)
MAESHRLYVKGKHLSYQRSKRVNNPNVSLIKIEGVATPQEAQFYLGKRIAYVYRASKEVR
GSKIRVMWGKVTRTHGNSGVVRATFRNNLPAKTFGASVRIFLYPSNI