Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOR226C  from Saccharomyces cerevisiae S288C
>YOR226C|YOR226C ISU2 SGDID:S000005752, Chr XV from 762084-761614, Genome Release 64-1-1, reverse complement, Verified ORF, "Conserved protein of the mitochondrial matrix, required for synthesis of mitochondrial and cytosolic iron-sulfur proteins, performs a scaffolding function in mitochondria during Fe/S cluster assembly; isu1 isu2 double mutant is inviable" ORGANISM: Saccharomyces cerevisiae S288C (156 aa)
MFARLANPAHFKPLTGSHITRAAKRLYHPKVIDHYTNPRNVGSMDKSLANVGTGIVGAPA
CGDVIKLQIQVNDKSGIIENVKFKTFGCGSAIASSSYMTELVRGMSLDEAVKIKNTEIAK
ELSLPPVKLHCSMLAEDAIKAAIKDYKTKRNPSVLH