Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YOR210W  from Saccharomyces cerevisiae S288C
>YOR210W|YOR210W RPB10 SGDID:S000005736, Chr XV from 738320-738532, Genome Release 64-1-1, Verified ORF, "RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III" ORGANISM: Saccharomyces cerevisiae S288C (70 aa)
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKF
LRYNPLEKRD