Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YOR192C-C  from Saccharomyces cerevisiae S288C
>YOR192C-C|YOR192C-C YOR192C-C SGDID:S000028857, Chr XV from 704224-703988, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; identified by expression profiling and mass spectrometry" ORGANISM: Saccharomyces cerevisiae S288C (78 aa)
MMIIIFIELCRIADSLSWIPKSLRRTSSTFYIPNIIALLKMESQQLSQNSPTFQKHTPIG
HINHDQYNSDSGSYYTLM