Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOR189W  from Saccharomyces cerevisiae S288C
>YOR189W|YOR189W IES4 SGDID:S000005715, Chr XV from 689624-689974, Genome Release 64-1-1, Verified ORF, "Component of the INO80 chromatiin remodeling complex and target of the Mec1p/Tel1p DNA damage signaling pathway; proposed to link chromatin remodeling to replication checkpoint responses" ORGANISM: Saccharomyces cerevisiae S288C (116 aa)
MSQESSVLSESQEQLANNPKIEDTSPPSANSRDNSKPVLPWDYKNKAIEIKSFSGYKVNF
TGWIRRDVREERQRGSEFTASDVKGSDDKATRKKEPADEDPEVKQLEKEGEDGLDS