Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOR186W  from Saccharomyces cerevisiae S288C
>YOR186W|YOR186W YOR186W SGDID:S000005712, Chr XV from 683111-683545, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; proper regulation of expression during heat stress is sphingolipid-dependent" ORGANISM: Saccharomyces cerevisiae S288C (144 aa)
MTLAFTTFAISKINNSSTNEDSKVMILCDEHHPFEKGYFKSAIRAFGNSIKLGLMGNSRP
EDAASIFQDKNIPHDLTTEEFRLQLVCMAFSWFIFGLFIACLLLCITLVLTSRYPGENEN
KATEVVPSSNIDDEEKQLSLSDMI