Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOR185C  from Saccharomyces cerevisiae S288C
>YOR185C|YOR185C GSP2 SGDID:S000005711, Chr XV from 682106-681444, Genome Release 64-1-1, reverse complement, Verified ORF, "GTP binding protein (mammalian Ranp homolog) involved in the maintenance of nuclear organization, RNA processing and transport; interacts with Kap121p, Kap123p and Pdr6p (karyophilin betas); Gsp1p homolog that is not required for viability" ORGANISM: Saccharomyces cerevisiae S288C (220 aa)
MSAPAQNNAEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFG
EIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPI
VLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFV
ASPALAPPEVQVDEQLMHQYQQEMDQATALPLPDEDDADL