Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOR182C  from Saccharomyces cerevisiae S288C
>YOR182C|YOR182C RPS30B SGDID:S000005708, Chr XV from 678379-678191,678793-678791, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps30Ap and has similarity to rat S30 ribosomal protein" ORGANISM: Saccharomyces cerevisiae S288C (63 aa)
MAKVHGSLARAGKVKSQTPKVEKTEKPKKPKGRAYKRLLYTRRFVNVTLVNGKRRMNPGP
SVQ