Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOR167C  from Saccharomyces cerevisiae S288C
>YOR167C|YOR167C RPS28A SGDID:S000005693, Chr XV from 649007-648804, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps28Bp and has similarity to rat S28 ribosomal protein" ORGANISM: Saccharomyces cerevisiae S288C (67 aa)
MDNKTPVTLAKVIKVLGRTGSRGGVTQVRVEFLEDTSRTIVRNVKGPVRENDILVLMESE
REARRLR