Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOR163W  from Saccharomyces cerevisiae S288C
>YOR163W|YOR163W DDP1 SGDID:S000005689, Chr XV from 642741-643307, Genome Release 64-1-1, Verified ORF, "Polyphosphate phosphatase; hydrolyzes diphosphorylated inositol polyphosphates and diadenosine polyphosphates; has high specificity for diadenosine hexa- and pentaphosphates; exhibits endopolyphosphatase activity with a high affinity for polyphosphates, an activity also observed for its human DIPP homologs; member of the MutT family of nucleotide hydrolases" ORGANISM: Saccharomyces cerevisiae S288C (188 aa)
MGKTADNHGPVRSETAREGRENQVYSPVTGARLVAGCICLTPDKKQVLMITSSAHKKRWI
VPKGGVEKDEPNYETTAQRETWEEAGCIGKIVANLGTVEDMRPPKDWNKDIKQFENSRKD
SEVAKHPPRTEFHFYELEIENLLDKFPECHKRHRKLYSYTEAKQNLIDAKRPELLEALNR
SAIIKDDK