Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YOR161C-C  from Saccharomyces cerevisiae S288C
>YOR161C-C|YOR161C-C YOR161C-C SGDID:S000028712, Chr XV from 639267-639121, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching" ORGANISM: Saccharomyces cerevisiae S288C (48 aa)
MSYTRVDHPTGKMACHLRQILASPLFFANYVLHAAIHYPSSDIRGDIL