>YOR159C|YOR159C SME1 SGDID:S000005685, Chr XV from 633566-633282, Genome Release 64-1-1, reverse complement, Verified ORF, "Core Sm protein Sm E; part of heteroheptameric complex (with Smb1p, Smd1p, Smd2p, Smd3p, Smx3p, and Smx2p) that is part of the spliceosomal U1, U2, U4, and U5 snRNPs; homolog of human Sm E" ORGANISM: Saccharomyces cerevisiae S288C (94 aa)
MSNKVKTKAMVPPINCIFNFLQQQTPVTIWLFEQIGIRIKGKIVGFDEFMNVVIDEAVEI
PVNSADGKEDVEKGTPLGKILLKGDNITLITSAD