Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOR148C  from Saccharomyces cerevisiae S288C
>YOR148C|YOR148C SPP2 SGDID:S000005674, Chr XV from 609197-608640, Genome Release 64-1-1, reverse complement, Verified ORF, "Essential protein that promotes the first step of splicing and is required for the final stages of spliceosome maturation; interacts with Prp2p, which may release Spp2p from the spliceosome following the first cleavage reaction" ORGANISM: Saccharomyces cerevisiae S288C (185 aa)
MSKFSLKLGSKTLKKNISKKTKKKNSLQKANLFDWDDAETASLSHKPQSKIKIQSIDKFD
LDEESSSKKKLVIKLSENADTKKNDAPLVEYVTEKEYNEVPVEEFGDALLRGMGWESDSE
QDSKGDKTQSRNKDVSNVSQIHPDGLGIGAKLNKAINVEEASFMPVVKIDKITGTKVDDD
KKNKS