Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOR125C  from Saccharomyces cerevisiae S288C
>YOR125C|YOR125C CAT5 SGDID:S000005651, Chr XV from 559731-559030, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein required for ubiquinone (Coenzyme Q) biosynthesis; localizes to the matrix face of the mitochondrial inner membrane in a large complex with ubiquinone biosynthetic enzymes; required for gluconeogenic gene activation" ORGANISM: Saccharomyces cerevisiae S288C (233 aa)
MLSRVSVFKPASRGFSVLSSLKITEHTSAKHTEKPEHAPKCQNLSDAQAAFLDRVIRVDQ
AGELGADYIYAGQYFVLAHRYPHLKPVLKHIWDQEIHHHNTFNNLQLKRRVRPSLLTPLW
KAGAFAMGAGTALISPEAAMACTEAVETVIGGHYNGQLRNLANQFNLERTDGTKGPSEEI
KSLTSTIQQFRDDELEHLDTAIKHDSYMAVPYTVITEGIKTICRVAIWSAERI