Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOR122C  from Saccharomyces cerevisiae S288C
>YOR122C|YOR122C PFY1 SGDID:S000005648, Chr XV from 552665-552298,552887-552875, Genome Release 64-1-1, reverse complement, Verified ORF, "Profilin, binds actin, phosphatidylinositol 4,5-bisphosphate, and polyproline regions; involved in cytoskeleton organization; required for normal timing of actin polymerization in response to thermal stress" ORGANISM: Saccharomyces cerevisiae S288C (126 aa)
MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG
LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY
LIGVQY