Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOR089C  from Saccharomyces cerevisiae S288C
>YOR089C|YOR089C VPS21 SGDID:S000005615, Chr XV from 490828-490196, Genome Release 64-1-1, reverse complement, Verified ORF, "Rab family GTPase required for endocytic transport and for sorting of vacuolar hydrolases; localized in endocytic intermediates; detected in mitochondria; geranylgeranylation required for membrane association; mammalian Rab5 homolog" ORGANISM: Saccharomyces cerevisiae S288C (210 aa)
MNTSVTSIKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEHTVKFEI
WDTAGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQASKDIIIALVGN
KIDMLQEGGERKVAREEGEKLAEEKGLLFFETSAKTGENVNDVFLGIGEKIPLKTAEEQN
SASNERESNNQRVDLNAANDGTSANSACSC