Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YOR072W-B  from Saccharomyces cerevisiae S288C
>YOR072W-B|YOR072W-B YOR072W-B SGDID:S000028516, Chr XV from 464469-464630, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; identified by expression profiling and mass spectrometry" ORGANISM: Saccharomyces cerevisiae S288C (53 aa)
MILALGDFLTNRKTKHARGPGFNSQLAPFIFDYLFPIGRVTDFFYFFQGPFVL