Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOR064C  from Saccharomyces cerevisiae S288C
>YOR064C|YOR064C YNG1 SGDID:S000005590, Chr XV from 446738-446079, Genome Release 64-1-1, reverse complement, Verified ORF, "Subunit of the NuA3 histone acetyltransferase complex that acetylates histone H3; contains PHD finger domain that interacts with methylated histone H3, has similarity to the human tumor suppressor ING1" ORGANISM: Saccharomyces cerevisiae S288C (219 aa)
MEHLANENSDSDIRYSFLSTLDHLPCELIRSLRLMQTIDLFKNEEDEPGMERACRDLLLV
ATYINDLVDDQIHFLKQHKKELEIQKSVTKNFNSSLENIKSKLTLEEPGAYKEPKLLLKI
NLKKAKSRERKESITSPTIGINQGDVTEGNNNQEEVYCFCRNVSYGPMVACDNPACPFEW
FHYGCVGLKQAPKGKWYCSKDCKEIANQRSKSKRQKRRK