>YOR052C|YOR052C YOR052C SGDID:S000005578, Chr XV from 427224-426772, Genome Release 64-1-1, reverse complement, Verified ORF, "Nuclear protein of unknown function; expression induced by nitrogen limitation in a GLN3, GAT1-independent manner and by weak acid; transcriptionally regulated by Rpn4p along with proteasome subunit genes; putative ortholog of human AIRAP, which stimulates proteasome activity in response to arsenic" ORGANISM: Saccharomyces cerevisiae S288C (150 aa)
MSDINEIEIPSRKDEIRQVTPKDPMHEIEDKSTYHAKIKKSDSGTVLGAIPLNSRSSSNS
SVTSTGQSSRRVTKKTTKKKKKNACYFDTCSSAASKFIGDCNFCKGHFCSKHRLMENHAC
NGLTSCKEQLHQRNADKLEAEQTKAPKIQI