Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOR045W  from Saccharomyces cerevisiae S288C
>YOR045W|YOR045W TOM6 SGDID:S000005571, Chr XV from 413852-414037, Genome Release 64-1-1, Verified ORF, "Component of the TOM (translocase of outer membrane) complex responsible for recognition and initial import steps for all mitochondrially directed proteins; promotes assembly and stability of the TOM complex" ORGANISM: Saccharomyces cerevisiae S288C (61 aa)
MDGMFAMPGAAAGAASPQQPKSRFQAFKESPLYTIALNGAFFVAGVAFIQSPLMDMLAPQ
L