Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOR044W  from Saccharomyces cerevisiae S288C
>YOR044W|YOR044W IRC23 SGDID:S000005570, Chr XV from 413007-413480, Genome Release 64-1-1, Verified ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion localizes to the ER; null mutant displays increased levels of spontaneous Rad52p foci" ORGANISM: Saccharomyces cerevisiae S288C (157 aa)
MIEALEIVLLLVIQSLQYICRTCIAFLLIPFLGLYAFDLFLYVYRMILYLSQMFNYKRKL
GRSKTNNRPHSPRLHKIYSSGDCMDTLIGQVRDLRVFLLSTIHSHSKRFFSTRFQTKSGI
NSAIDANDVETTSDVSSFTNLHLTRSSEEGYYIAGSI