Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOR034C-A  from Saccharomyces cerevisiae S288C
>YOR034C-A|YOR034C-A YOR034C-A SGDID:S000028856, Chr XV from 397668-397426, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; identified by expression profiling and mass spectrometry" ORGANISM: Saccharomyces cerevisiae S288C (80 aa)
MNTQELCKIFVAREYPLVVVPFIYFVLFLHQKYHTTLNYVWYPTCSKRIWVREKGRKCSF
FFFSKVPRSDGFANNRCQRK