Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YOR032W-A  from Saccharomyces cerevisiae S288C
>YOR032W-A|YOR032W-A YOR032W-A SGDID:S000028710, Chr XV from 392176-392376, Genome Release 64-1-1, Uncharacterized ORF, "Identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching" ORGANISM: Saccharomyces cerevisiae S288C (66 aa)
MRRALFIAGQTYLWLNLTHLLLIFSWSSTMAFSQSRRLLTPTVPCPTLLGIDFLILVLRH
FDEIFI