Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YOR031W  from Saccharomyces cerevisiae S288C
>YOR031W|YOR031W CRS5 SGDID:S000005557, Chr XV from 389213-389422, Genome Release 64-1-1, Verified ORF, "Copper-binding metallothionein, required for wild-type copper resistance" ORGANISM: Saccharomyces cerevisiae S288C (68 aa)
MTVKICDCGECCKDSCHCGSTCLPSCSGGEKCKCDHSTGSPQCKSCGEKCKCETTCTCEK
SKCNCEKC