>YOR020C|YOR020C HSP10 SGDID:S000005546, Chr XV from 370844-370524, Genome Release 64-1-1, reverse complement, Verified ORF, "Mitochondrial matrix co-chaperonin that inhibits the ATPase activity of Hsp60p, a mitochondrial chaperonin; involved in protein folding and sorting in the mitochondria; 10 kD heat shock protein with similarity to E. coli groES" ORGANISM: Saccharomyces cerevisiae S288C (106 aa)
MSTLLKSAKSIVPLMDRVLVQRIKAQAKTASGLYLPEKNVEKLNQAEVVAVGPGFTDANG
NKVVPQVKVGDQVLIPQFGGSTIKLGNDDEVILFRDAEILAKIAKD