Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YOR008C-A  from Saccharomyces cerevisiae S288C
>YOR008C-A|YOR008C-A YOR008C-A SGDID:S000006431, Chr XV from 343081-342857, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function, includes a potential transmembrane domain; deletion results in slightly lengthened telomeres" ORGANISM: Saccharomyces cerevisiae S288C (74 aa)
MWRSYLVFLFFMTPRIQTYCPVPVLRSMAVLNIISPLIIFVSPIKKQDSLHSSACYANLT
LVEKLQLWHSMSND