Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YOL166W-A  from Saccharomyces cerevisiae S288C
>YOL166W-A|YOL166W-A YOL166W-A SGDID:S000028709, Chr XV from 585-740, Genome Release 64-1-1, Uncharacterized ORF, "Identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching" ORGANISM: Saccharomyces cerevisiae S288C (51 aa)
MHGACLSGLYPLPFTHKFHDYLHFNIYISFGGPKYCITALNTYVILFYTVY