Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOL161C  from Saccharomyces cerevisiae S288C
>YOL161C|YOL161C PAU20 SGDID:S000005521, Chr XV from 11911-11549, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein of unknown function, member of the seripauperin multigene family encoded mainly in subtelomeric regions; expression induced by low temperature and also by anaerobic conditions; induced during alcoholic fermentation" ORGANISM: Saccharomyces cerevisiae S288C (120 aa)
MVKLTSIAAGVAAIAAGASATTTLAQSDERVNLVELGVYVSDIRAHLAQYYMFQAAHPTE
TYPVEVAEAVFNYGDFTTMLTGISPDQVTRMITGVPWYSTRLKPAISKALSKDGIYTIAN