Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOL155W-A  from Saccharomyces cerevisiae S288C
>YOL155W-A|YOL155W-A YOL155W-A SGDID:S000028855, Chr XV from 27084-27218, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; identified by expression profiling and mass spectrometry" ORGANISM: Saccharomyces cerevisiae S288C (44 aa)
MFYGSFNKCVTGYSCRMAIHYYVYRIIKSATRPDYKSNTQILVL