Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOL149W  from Saccharomyces cerevisiae S288C
>YOL149W|YOL149W DCP1 SGDID:S000005509, Chr XV from 44938-45633, Genome Release 64-1-1, Verified ORF, "Subunit of the Dcp1p-Dcp2p decapping enzyme complex, which removes the 5' cap structure from mRNAs prior to their degradation; enhances the activity of catalytic subunit Dcp2p; regulated by DEAD box protein Dhh1p" ORGANISM: Saccharomyces cerevisiae S288C (231 aa)
MTGAATAAENSATQLEFYRKALNFNVIGRYDPKIKQLLFHTPHASLYKWDFKKDEWNKLE
YQGVLAIYLRDVSQNTNLLPVSPQEVDIFDSQNGSNNIQVNNGSDNSNRNSSGNGNSYKS
NDSLTYNCGKTLSGKDIYNYGLIILNRINPDNFSMGIVPNSVVNKRKVFNAEEDTLNPLE
CMGVEVKDELVIIKNLKHEVYGIWIHTVSDRQNIYELIKYLLENEPKDSFA