Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOL147C  from Saccharomyces cerevisiae S288C
>YOL147C|YOL147C PEX11 SGDID:S000005507, Chr XV from 48643-47933, Genome Release 64-1-1, reverse complement, Verified ORF, "Peroxisomal membrane protein required for medium-chain fatty acid oxidation and peroxisome proliferation, possibly by inducing membrane curvature; localization regulated by phosphorylation; transcription regulated by Adr1p and Pip2p-Oaf1p" ORGANISM: Saccharomyces cerevisiae S288C (236 aa)
MVCDTLVYHPSVTRFVKFLDGSAGREKVLRLLQYLARFLAVQNSSLLARQLQAQFTTVRK
FLRFLKPLNHLQAAAKFYDNKLASDNVVRVCNVLKNIFFAAYLSLDQVNLLRILKVIPVT
VLTGKKIPRWSNWCWLFGLLSGLAMDLRKIQTSHAQIAAFVKAKSQSQGDEHEDHKKVLG
KAYQDRYTALRRLFWDAADSFIVLNNLGYLSSNEEYVALSGVVTSILGMQDMWKAT