Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOL143C  from Saccharomyces cerevisiae S288C
>YOL143C|YOL143C RIB4 SGDID:S000005503, Chr XV from 55104-54595, Genome Release 64-1-1, reverse complement, Verified ORF, "Lumazine synthase (6,7-dimethyl-8-ribityllumazine synthase, also known as DMRL synthase); catalyzes synthesis of immediate precursor to riboflavin" ORGANISM: Saccharomyces cerevisiae S288C (169 aa)
MAVKGLGKPDQVYDGSKIRVGIIHARWNRVIIDALVKGAIERMASLGVEENNIIIETVPG
SYELPWGTKRFVDRQAKLGKPLDVVIPIGVLIKGSTMHFEYISDSTTHALMNLQEKVDMP
VIFGLLTCMTEEQALARAGIDEAHSMHNHGEDWGAAAVEMAVKFGKNAF